Lineage for d3bu8b1 (3bu8 B:44-245)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.146: Telomeric repeat binding factor (TRF) dimerisation domain [63599] (1 superfamily)
multihelical; can be divided into an alpha-alpha superhelix domain and a long alpha-hairpin dimerization domainSuperfamily a.146.1: Telomeric repeat binding factor (TRF) dimerisation domain [63600] (1 family) 
Family a.146.1.1: Telomeric repeat binding factor (TRF) dimerisation domain [63601] (2 proteins) 
Protein TRF2 [63604] (1 species) Species Human (Homo sapiens) [TaxId:9606] [63605] (3 PDB entries) 
Domain d3bu8b1: 3bu8 B:44-245 [155596]
automatically matched to d1h6pa_
Details for d3bu8b1
PDB Entry: 3bu8 (more details), 2.15 Å
PDB Description: Crystal Structure of TRF2 TRFH domain and TIN2 peptide complex
PDB Compounds: (B:) Telomeric repeat-binding factor 2SCOP Domain Sequences for d3bu8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bu8b1 a.146.1.1 (B:44-245) TRF2 {Human (Homo sapiens) [TaxId: 9606]}
gearleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrllrv
mqclsrieegenldcsfdmeaeltplesainvlemikteftlteavvessrklvkeaavi
iciknkefekaskilkkhmskdpttqklrndllniireknlahpviqnfsyetfqqkmlr
fleshlddaepylltmakkalk
SCOP Domain Coordinates for d3bu8b1:
Click to download the PDB-style file with coordinates for d3bu8b1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3bu8b1:
- d3bu8b1 is new in SCOP 1.75
- d3bu8b1 appears in SCOPe 2.01
- d3bu8b1 appears in the current release, SCOPe 2.08, called d3bu8b_
View in 3D
