SCOPe 2.02: Domain d3btje2: 3btj E:73-187

Lineage for d3btje2 (3btj E:73-187)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins)

6. Protein Multidrug binding protein QacR [69107] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [69108] (20 PDB entries)
   Uniprot P23217

8. Domain d3btje2: 3btj E:73-187 [155581]
   Other proteins in same PDB: d3btja1, d3btjb1, d3btjd1, d3btje1
   automatically matched to d1jt0a2
   complexed with deq, so4

Details for d3btje2

PDB Entry: 3btj, 2.98 Å

PDB Description: crystal structure of qacr(e58q) bound to dequalinium

PDB Compounds: (E:) HTH-type transcriptional regulator qacR

SCOPe Domain Sequences for d3btje2:

Sequence; same for both SEQRES and ATOM records:

>d3btje2 a.121.1.1 (E:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

Timeline for d3btje2:

• d3btje2 first appeared in SCOP 1.75
  
• d3btje2 appears in SCOPe 2.01
  
• d3btje2 appears in SCOPe 2.03
  
• d3btje2 appears in the current release, SCOPe 2.08