Class a: All alpha proteins [46456] (284 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins) |
Protein Multidrug binding protein QacR [69107] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [69108] (20 PDB entries) Uniprot P23217 |
Domain d3btjb2: 3btj B:73-187 [155577] Other proteins in same PDB: d3btja1, d3btjb1, d3btjd1, d3btje1 automatically matched to d1jt0a2 complexed with deq, so4 |
PDB Entry: 3btj (more details), 2.98 Å
SCOPe Domain Sequences for d3btjb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3btjb2 a.121.1.1 (B:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]} ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls
Timeline for d3btjb2: