SCOPe 2.07: Domain d2dhbb_: 2dhb B:

Lineage for d2dhbb_ (2dhb B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (26 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46504] (19 PDB entries)

8. Domain d2dhbb_: 2dhb B: [15556]
   Other proteins in same PDB: d2dhba_
   complexed with hem

Details for d2dhbb_

PDB Entry: 2dhb, 2.8 Å

PDB Description: three dimensional fourier synthesis of horse deoxyhaemoglobin at 2.8 angstroms resolution

PDB Compounds: (B:) hemoglobin (deoxy) (beta chain)

SCOPe Domain Sequences for d2dhbb_:

Sequence; same for both SEQRES and ATOM records:

>d2dhbb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlalvvarhfgk
dftpelqasyqkvvagvanalahkyh

Timeline for d2dhbb_:

• d2dhbb_ first appeared (with stable ids) in SCOP 1.55
  
• d2dhbb_ appears in SCOPe 2.06
  
• d2dhbb_ appears in the current release, SCOPe 2.08