Lineage for d2dhbb_ (2dhb B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. Protein Hemoglobin, beta-chain [46500] (26 species)
  7. Species Horse (Equus caballus) [TaxId:9796] [46504] (19 PDB entries)
  8. Domain d2dhbb_: 2dhb B: [15556]
    Other proteins in same PDB: d2dhba_
    complexed with hem

Details for d2dhbb_

PDB Entry: 2dhb (more details), 2.8 Å

PDB Description: three dimensional fourier synthesis of horse deoxyhaemoglobin at 2.8 angstroms resolution
PDB Compounds: (B:) hemoglobin (deoxy) (beta chain)

SCOPe Domain Sequences for d2dhbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dhbb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlalvvarhfgk
dftpelqasyqkvvagvanalahkyh

SCOPe Domain Coordinates for d2dhbb_ are not available.

Timeline for d2dhbb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2dhba_