Lineage for d3biie_ (3bii E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2551902Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2552293Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families) (S)
  5. 2552294Family d.41.5.1: Molybdopterin synthase subunit MoaE [54691] (1 protein)
    automatically mapped to Pfam PF02391
  6. 2552295Protein Molybdopterin synthase subunit MoaE [54692] (1 species)
  7. 2552296Species Escherichia coli [TaxId:562] [54693] (5 PDB entries)
  8. 2552306Domain d3biie_: 3bii E: [155308]
    Other proteins in same PDB: d3biid_
    automated match to d1fm0e_
    complexed with cl

Details for d3biie_

PDB Entry: 3bii (more details), 2.5 Å

PDB Description: crystal structure of activated mpt synthase
PDB Compounds: (E:) Molybdopterin-converting factor subunit 2

SCOPe Domain Sequences for d3biie_:

Sequence, based on SEQRES records: (download)

>d3biie_ d.41.5.1 (E:) Molybdopterin synthase subunit MoaE {Escherichia coli [TaxId: 562]}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrnhnlgdsvnaltlehypgmtek
alaeivdearnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktr
apfwkreatpegdrwvearesdqqaakrw

Sequence, based on observed residues (ATOM records): (download)

>d3biie_ d.41.5.1 (E:) Molybdopterin synthase subunit MoaE {Escherichia coli [TaxId: 562]}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrvnaltlehypgmtekalaeivd
earnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktrapfwkre
atpegdrwvearesdqqaakrw

SCOPe Domain Coordinates for d3biie_:

Click to download the PDB-style file with coordinates for d3biie_.
(The format of our PDB-style files is described here.)

Timeline for d3biie_: