![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
![]() | Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families) ![]() |
![]() | Family d.41.5.1: Molybdopterin synthase subunit MoaE [54691] (1 protein) automatically mapped to Pfam PF02391 |
![]() | Protein Molybdopterin synthase subunit MoaE [54692] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [54693] (5 PDB entries) |
![]() | Domain d3biie_: 3bii E: [155308] Other proteins in same PDB: d3biid_ automated match to d1fm0e_ complexed with cl |
PDB Entry: 3bii (more details), 2.5 Å
SCOPe Domain Sequences for d3biie_:
Sequence, based on SEQRES records: (download)
>d3biie_ d.41.5.1 (E:) Molybdopterin synthase subunit MoaE {Escherichia coli [TaxId: 562]} aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrnhnlgdsvnaltlehypgmtek alaeivdearnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktr apfwkreatpegdrwvearesdqqaakrw
>d3biie_ d.41.5.1 (E:) Molybdopterin synthase subunit MoaE {Escherichia coli [TaxId: 562]} aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrvnaltlehypgmtekalaeivd earnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktrapfwkre atpegdrwvearesdqqaakrw
Timeline for d3biie_: