Lineage for d3bhud1 (3bhu D:181-308)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1091941Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1091942Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 1091943Family a.74.1.1: Cyclin [47955] (8 proteins)
  6. 1091956Protein Cyclin A [47956] (2 species)
  7. 1091957Species Cow (Bos taurus) [TaxId:9913] [47958] (8 PDB entries)
  8. 1091974Domain d3bhud1: 3bhu D:181-308 [155283]
    Other proteins in same PDB: d3bhua_, d3bhuc_
    automatically matched to d1vina1
    complexed with mg, mhr

Details for d3bhud1

PDB Entry: 3bhu (more details), 2.3 Å

PDB Description: structure of phosphorylated thr160 cdk2/cyclin a in complex with the inhibitor meriolin 5
PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d3bhud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bhud1 a.74.1.1 (D:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vlafdlaa

SCOPe Domain Coordinates for d3bhud1:

Click to download the PDB-style file with coordinates for d3bhud1.
(The format of our PDB-style files is described here.)

Timeline for d3bhud1: