SCOPe 2.07: Domain d3bhud1: 3bhu D:171-308

Lineage for d3bhud1 (3bhu D:171-308)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47958] (10 PDB entries)

8. Domain d3bhud1: 3bhu D:171-308 [155283]
   Other proteins in same PDB: d3bhua1, d3bhua2, d3bhuc1, d3bhuc2
   automated match to d3ddqb1
   complexed with mg, mhr

Details for d3bhud1

PDB Entry: 3bhu, 2.3 Å

PDB Description: structure of phosphorylated thr160 cdk2/cyclin a in complex with the inhibitor meriolin 5

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d3bhud1:

Sequence; same for both SEQRES and ATOM records:

>d3bhud1 a.74.1.1 (D:171-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
svnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqne
tlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkq
vlrmehlvlkvlafdlaa

Timeline for d3bhud1:

• d3bhud1 first appeared in SCOP 1.75
  
• d3bhud1 appears in SCOPe 2.06