| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (3 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (8 proteins) |
| Protein Cyclin A [47956] (2 species) |
| Species Cow (Bos taurus) [TaxId:9913] [47958] (25 PDB entries) |
| Domain d3bhtd2: 3bht D:309-432 [155280] Other proteins in same PDB: d3bhta_, d3bhtc_ automatically matched to d1vina2 complexed with mfr, mg, sgm |
PDB Entry: 3bht (more details), 2 Å
SCOPe Domain Sequences for d3bhtd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bhtd2 a.74.1.1 (D:309-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
ptinqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaafhlalytvt
gqswpeslvqktgytletlkpclldlhqtylrapqhaqqsirekyknskyhgvsllnppe
tlnv
Timeline for d3bhtd2:
View in 3DDomains from other chains: (mouse over for more information) d3bhta_, d3bhtb1, d3bhtb2, d3bhtc_ |