Lineage for d3bhtd2 (3bht D:309-432)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.74: Cyclin-like [47953] (1 superfamily)
core: 5 helices; one helix is surrounded by the othersSuperfamily a.74.1: Cyclin-like [47954] (4 families) 
duplication: consists of two domains of this foldFamily a.74.1.1: Cyclin [47955] (9 proteins) 
Protein Cyclin A [47956] (2 species) 
Species Cow (Bos taurus) [TaxId:9913] [47958] (9 PDB entries) 
Domain d3bhtd2: 3bht D:309-432 [155280]
Other proteins in same PDB: d3bhta2, d3bhta3, d3bhtc1, d3bhtc2
automated match to d1vina2
complexed with mfr, mg, sgm
Details for d3bhtd2
PDB Entry: 3bht (more details), 2 Å
PDB Description: Structure of phosphorylated Thr160 CDK2/cyclin A in complex with the inhibitor meriolin 3
PDB Compounds: (D:) Cyclin-A2SCOPe Domain Sequences for d3bhtd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bhtd2 a.74.1.1 (D:309-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
ptinqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaafhlalytvt
gqswpeslvqktgytletlkpclldlhqtylrapqhaqqsirekyknskyhgvsllnppe
tlnv
SCOPe Domain Coordinates for d3bhtd2:
Click to download the PDB-style file with coordinates for d3bhtd2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3bhtd2:
- d3bhtd2 first appeared in SCOP 1.75
- d3bhtd2 appears in SCOPe 2.07
View in 3D
