SCOPe 2.08: Domain d3bhma_: 3bhm A:

Lineage for d3bhma_ (3bhm A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein Carbonyl reductase/20beta-hydroxysteroid dehydrogenase [63935] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141878] (6 PDB entries)
   Uniprot P16152 2-276

8. Domain d3bhma_: 3bhm A: [155275]
   automated match to d1wmaa1
   complexed with ab3, ahe, nap, so4

Details for d3bhma_

PDB Entry: 3bhm, 1.8 Å

PDB Description: crystal structure of human carbonyl reductase 1 in complex with s- hydroxymethylglutathione

PDB Compounds: (A:) Carbonyl reductase [NADPH] 1

SCOPe Domain Sequences for d3bhma_:

Sequence; same for both SEQRES and ATOM records:

>d3bhma_ c.2.1.2 (A:) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
gihvalvtggnkgiglaivrdlcrlfsgdvvltardvtrgqaavqqlqaeglsprfhqld
iddlqsiralrdflrkeyggldvlvnnagiafkvadptpfhiqaevtmktnffgtrdvct
ellplikpqgrvvnvssimsvralkscspelqqkfrsetiteeelvglmnkfvedtkkgv
hqkegwpssaygvtkigvtvlsriharklseqrkgdkillnaccpgwvrtdmagpkatks
peegaetpvylallppdaegphgqfvsekrveqw

Timeline for d3bhma_:

• d3bhma_ first appeared in SCOP 1.75, called d3bhma1
  
• d3bhma_ appears in SCOPe 2.07