Lineage for d3bedb_ (3bed B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137127Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2137128Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) (S)
    active dimer is formed by strand 5 swapping
  5. 2137159Family c.54.1.0: automated matches [191356] (1 protein)
    not a true family
  6. 2137160Protein automated matches [190395] (7 species)
    not a true protein
  7. 2137168Species Enterococcus faecalis [TaxId:226185] [187262] (1 PDB entry)
  8. 2137169Domain d3bedb_: 3bed B: [155184]
    Other proteins in same PDB: d3beda1
    automated match to d1pdoa_

Details for d3bedb_

PDB Entry: 3bed (more details), 1.45 Å

PDB Description: Mannose/sorbose specific IIA subunit of phosphotransferase system from Enterococcus faecalis
PDB Compounds: (B:) PTS system, IIA component

SCOPe Domain Sequences for d3bedb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bedb_ c.54.1.0 (B:) automated matches {Enterococcus faecalis [TaxId: 226185]}
mkpklilmshgrmaeetlastqmivgeladaaivsmtaedglsgtqaklaailkeagnvp
tlvladlkggtpcnvammamgtypqlrvvaglnlamaieaavspvenvdelaayltqigq
savttidlp

SCOPe Domain Coordinates for d3bedb_:

Click to download the PDB-style file with coordinates for d3bedb_.
(The format of our PDB-style files is described here.)

Timeline for d3bedb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3beda1