| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) ![]() active dimer is formed by strand 5 swapping |
| Family c.54.1.0: automated matches [191356] (1 protein) not a true family |
| Protein automated matches [190395] (7 species) not a true protein |
| Species Enterococcus faecalis [TaxId:226185] [187262] (1 PDB entry) |
| Domain d3bedb_: 3bed B: [155184] Other proteins in same PDB: d3beda1 automated match to d1pdoa_ |
PDB Entry: 3bed (more details), 1.45 Å
SCOPe Domain Sequences for d3bedb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bedb_ c.54.1.0 (B:) automated matches {Enterococcus faecalis [TaxId: 226185]}
mkpklilmshgrmaeetlastqmivgeladaaivsmtaedglsgtqaklaailkeagnvp
tlvladlkggtpcnvammamgtypqlrvvaglnlamaieaavspvenvdelaayltqigq
savttidlp
Timeline for d3bedb_: