Lineage for d3beda1 (3bed A:1-132)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137127Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2137128Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) (S)
    active dimer is formed by strand 5 swapping
  5. 2137129Family c.54.1.1: EIIA-man component-like [53063] (2 proteins)
  6. 2137139Protein PTS system, IIA subunit [159616] (1 species)
  7. 2137140Species Enterococcus faecalis [TaxId:1351] [159617] (2 PDB entries)
    Uniprot Q838I6 1-132
  8. 2137143Domain d3beda1: 3bed A:1-132 [155183]
    Other proteins in same PDB: d3bedb_

Details for d3beda1

PDB Entry: 3bed (more details), 1.45 Å

PDB Description: Mannose/sorbose specific IIA subunit of phosphotransferase system from Enterococcus faecalis
PDB Compounds: (A:) PTS system, IIA component

SCOPe Domain Sequences for d3beda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3beda1 c.54.1.1 (A:1-132) PTS system, IIA subunit {Enterococcus faecalis [TaxId: 1351]}
mkpklilmshgrmaeetlastqmivgeladaaivsmtaedglsgtqaklaailkeagnvp
tlvladlkggtpcnvammamgtypqlrvvaglnlamaieaavspvenvdelaayltqigq
savttidlpelt

SCOPe Domain Coordinates for d3beda1:

Click to download the PDB-style file with coordinates for d3beda1.
(The format of our PDB-style files is described here.)

Timeline for d3beda1:

View in 3D
Domains from other chains:
(mouse over for more information)
d3bedb_