| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) ![]() active dimer is formed by strand 5 swapping |
| Family c.54.1.1: EIIA-man component-like [53063] (2 proteins) |
| Protein PTS system, IIA subunit [159616] (1 species) |
| Species Enterococcus faecalis [TaxId:1351] [159617] (2 PDB entries) Uniprot Q838I6 1-132 |
| Domain d3beda1: 3bed A:1-132 [155183] Other proteins in same PDB: d3bedb_ |
PDB Entry: 3bed (more details), 1.45 Å
SCOPe Domain Sequences for d3beda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3beda1 c.54.1.1 (A:1-132) PTS system, IIA subunit {Enterococcus faecalis [TaxId: 1351]}
mkpklilmshgrmaeetlastqmivgeladaaivsmtaedglsgtqaklaailkeagnvp
tlvladlkggtpcnvammamgtypqlrvvaglnlamaieaavspvenvdelaayltqigq
savttidlpelt
Timeline for d3beda1: