SCOPe 2.07: Domain d3be7b1: 3be7 B:4-56,B:360-398

Lineage for d3be7b1 (3be7 B:4-56,B:360-398)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.9: Zn-dependent arginine carboxypeptidase-like [159340] (3 proteins)

6. Protein Zn-dependent arginine carboxypeptidase [159343] (1 species)

7. Species Unidentified organism [TaxId:32644] [159344] (2 PDB entries)

8. Domain d3be7b1: 3be7 B:4-56,B:360-398 [155165]
   Other proteins in same PDB: d3be7a2, d3be7a3, d3be7b2, d3be7c2, d3be7d2, d3be7e2, d3be7f2, d3be7g2, d3be7h2
   automatically matched to 3BE7 A:3-56,A:360-400
   complexed with arg, gol, mg

Details for d3be7b1

PDB Entry: 3be7, 2.3 Å

PDB Description: crystal structure of zn-dependent arginine carboxypeptidase

PDB Compounds: (B:) Zn-dependent arginine carboxypeptidase

SCOPe Domain Sequences for d3be7b1:

Sequence; same for both SEQRES and ATOM records:

>d3be7b1 b.92.1.9 (B:4-56,B:360-398) Zn-dependent arginine carboxypeptidase {Unidentified organism [TaxId: 32644]}
edflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipXqikegf
dadivgvienplanirtleevafvmkegkvykr

Timeline for d3be7b1:

• d3be7b1 first appeared in SCOP 1.75
  
• d3be7b1 appears in SCOPe 2.06
  
• d3be7b1 appears in the current release, SCOPe 2.08