Lineage for d3be7g1 (3be7 G:5-56,G:360-398)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428473Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 2428474Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 2428669Family b.92.1.9: Zn-dependent arginine carboxypeptidase-like [159340] (3 proteins)
  6. 2428684Protein Zn-dependent arginine carboxypeptidase [159343] (1 species)
  7. 2428685Species Unidentified organism [TaxId:32644] [159344] (2 PDB entries)
  8. 2428692Domain d3be7g1: 3be7 G:5-56,G:360-398 [155175]
    Other proteins in same PDB: d3be7a2, d3be7a3, d3be7b2, d3be7c2, d3be7d2, d3be7e2, d3be7f2, d3be7g2, d3be7h2
    automatically matched to 3BE7 A:3-56,A:360-400
    complexed with arg, gol, mg

Details for d3be7g1

PDB Entry: 3be7 (more details), 2.3 Å

PDB Description: crystal structure of zn-dependent arginine carboxypeptidase
PDB Compounds: (G:) Zn-dependent arginine carboxypeptidase

SCOPe Domain Sequences for d3be7g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3be7g1 b.92.1.9 (G:5-56,G:360-398) Zn-dependent arginine carboxypeptidase {Unidentified organism [TaxId: 32644]}
dflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipXqikegfd
adivgvienplanirtleevafvmkegkvykr

SCOPe Domain Coordinates for d3be7g1:

Click to download the PDB-style file with coordinates for d3be7g1.
(The format of our PDB-style files is described here.)

Timeline for d3be7g1: