Lineage for d3bbea_ (3bbe A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921212Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2921213Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2921389Family c.116.1.6: EMG1/NEP1-like [159513] (3 proteins)
    Pfam PF03587; structurally most similar to the AF1056-like family, but more decorated
  6. 2921394Protein Ribosome biogenesis protein NEP1 [159514] (1 species)
  7. 2921395Species Methanococcus jannaschii [TaxId:2190] [159515] (3 PDB entries)
    Uniprot Q57977 2-205
  8. 2921398Domain d3bbea_: 3bbe A: [155063]
    automated match to d3bbda1
    complexed with gol

Details for d3bbea_

PDB Entry: 3bbe (more details), 2.2 Å

PDB Description: M. jannaschii Nep1
PDB Compounds: (A:) Ribosome biogenesis protein NEP1-like

SCOPe Domain Sequences for d3bbea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bbea_ c.116.1.6 (A:) Ribosome biogenesis protein NEP1 {Methanococcus jannaschii [TaxId: 2190]}
tyniilaksalelipeeiknkirksrvykydildsnyhykameklkdkemrgrpdiihis
llnildspinhekklniyihtyddkvlkinpetrlprnyfrflgvmekvlkgernhlikm
eektledllneinakkiaimtktgklthpkllkeydtfiiggfpygklkinkekvfgdik
eisiynkglmawtvcgiicyslsf

SCOPe Domain Coordinates for d3bbea_:

Click to download the PDB-style file with coordinates for d3bbea_.
(The format of our PDB-style files is described here.)

Timeline for d3bbea_: