Lineage for d3b94b_ (3b94 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386843Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2386844Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2386845Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2386952Protein Glucocorticoid-induced TNF-related ligand, TNFSF18 [158982] (4 species)
  7. 2386953Species Human (Homo sapiens) [TaxId:9606] [158984] (6 PDB entries)
    Uniprot Q9UNG2 55-177! Uniprot Q9UNG2 57-172! Uniprot Q9UNG2 57-176
  8. 2386958Domain d3b94b_: 3b94 B: [154991]
    automated match to d3b93a1

Details for d3b94b_

PDB Entry: 3b94 (more details), 2.5 Å

PDB Description: crystal structure of human gitrl
PDB Compounds: (B:) Tumor necrosis factor ligand superfamily member 18

SCOPe Domain Sequences for d3b94b_:

Sequence, based on SEQRES records: (download)

>d3b94b_ b.22.1.1 (B:) Glucocorticoid-induced TNF-related ligand, TNFSF18 {Human (Homo sapiens) [TaxId: 9606]}
pcmakfgplpskwqmasseppcvnkvsdwkleilqnglyliygqvapnanyndvapfevr
lyknkdmiqtltnkskiqnvggtyelhvgdtidlifnsehqvlknntywgiillanpqf

Sequence, based on observed residues (ATOM records): (download)

>d3b94b_ b.22.1.1 (B:) Glucocorticoid-induced TNF-related ligand, TNFSF18 {Human (Homo sapiens) [TaxId: 9606]}
pcmakfgplpskwqmasseppcvnkvsdwkleilqnglyliygqvapndvapfevrlykn
kdmiqtltnkskiqnvggtyelhvgdtidlifnsevlknntywgiillanpqf

SCOPe Domain Coordinates for d3b94b_:

Click to download the PDB-style file with coordinates for d3b94b_.
(The format of our PDB-style files is described here.)

Timeline for d3b94b_: