Lineage for d3b93a1 (3b93 A:55-177)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386843Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2386844Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2386845Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2386952Protein Glucocorticoid-induced TNF-related ligand, TNFSF18 [158982] (4 species)
  7. 2386953Species Human (Homo sapiens) [TaxId:9606] [158984] (6 PDB entries)
    Uniprot Q9UNG2 55-177! Uniprot Q9UNG2 57-172! Uniprot Q9UNG2 57-176
  8. 2386954Domain d3b93a1: 3b93 A:55-177 [154987]

Details for d3b93a1

PDB Entry: 3b93 (more details), 2.2 Å

PDB Description: crystal structure of human GITRL
PDB Compounds: (A:) Tumor necrosis factor ligand superfamily member 18

SCOPe Domain Sequences for d3b93a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b93a1 b.22.1.1 (A:55-177) Glucocorticoid-induced TNF-related ligand, TNFSF18 {Human (Homo sapiens) [TaxId: 9606]}
kepcmakfgplpskwqmasseppcvnkvsdwkleilqnglyliygqvapnanyndvapfe
vrlyknkdmiqtltnkskiqnvggtyelhvgdtidlifnsehqvlknntywgiillanpq
fis

SCOPe Domain Coordinates for d3b93a1:

Click to download the PDB-style file with coordinates for d3b93a1.
(The format of our PDB-style files is described here.)

Timeline for d3b93a1: