SCOPe 2.04: Domain d3b7ta1: 3b7t A:461-610

Lineage for d3b7ta1 (3b7t A:461-610)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (26 families)

5. Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein)
   automatically mapped to Pfam PF09127
   this is a repeat family; one repeat unit is 1gw6 A:513-547 found in domain

6. Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63610] (45 PDB entries)
   Uniprot P09960

8. Domain d3b7ta1: 3b7t A:461-610 [154943]
   Other proteins in same PDB: d3b7ta2, d3b7ta3
   automated match to d3b7sa1
   complexed with imd, yb, zn

Details for d3b7ta1

PDB Entry: 3b7t, 2.3 Å

PDB Description: [e296q]lta4h in complex with arg-ala-arg substrate

PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d3b7ta1:

Sequence; same for both SEQRES and ATOM records:

>d3b7ta1 a.118.1.7 (A:461-610) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm
qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks
hdqavrtyqehkasmhpvtamlvgkdlkvd

Timeline for d3b7ta1:

• d3b7ta1 first appeared in SCOP 1.75
  
• d3b7ta1 appears in SCOPe 2.03
  
• d3b7ta1 appears in SCOPe 2.05
  
• d3b7ta1 appears in the current release, SCOPe 2.08