Class b: All beta proteins [48724] (174 folds) |
Fold b.98: Leukotriene A4 hydrolase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Leukotriene A4 hydrolase N-terminal domain [63737] (1 family) |
Family b.98.1.1: Leukotriene A4 hydrolase N-terminal domain [63738] (1 protein) |
Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63740] (15 PDB entries) Uniprot P09960 |
Domain d3b7sa2: 3b7s A:1-208 [154941] Other proteins in same PDB: d3b7sa1, d3b7sa3 automatically matched to d1gw6a2 complexed with acy, gol, yb, zn; mutant |
PDB Entry: 3b7s (more details), 1.47 Å
SCOP Domain Sequences for d3b7sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b7sa2 b.98.1.1 (A:1-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} peivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdlt iekvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltp eqtsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpd pedpsrkiykfiqkvpipcylialvvga
Timeline for d3b7sa2: