Lineage for d3b7sa2 (3b7s A:1-208)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811924Fold b.98: Leukotriene A4 hydrolase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 811925Superfamily b.98.1: Leukotriene A4 hydrolase N-terminal domain [63737] (1 family) (S)
  5. 811926Family b.98.1.1: Leukotriene A4 hydrolase N-terminal domain [63738] (1 protein)
  6. 811927Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species)
  7. 811928Species Human (Homo sapiens) [TaxId:9606] [63740] (15 PDB entries)
    Uniprot P09960
  8. 811929Domain d3b7sa2: 3b7s A:1-208 [154941]
    Other proteins in same PDB: d3b7sa1, d3b7sa3
    automatically matched to d1gw6a2
    complexed with acy, gol, yb, zn; mutant

Details for d3b7sa2

PDB Entry: 3b7s (more details), 1.47 Å

PDB Description: [e296q]lta4h in complex with rsr substrate
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOP Domain Sequences for d3b7sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b7sa2 b.98.1.1 (A:1-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
peivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdlt
iekvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltp
eqtsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpd
pedpsrkiykfiqkvpipcylialvvga

SCOP Domain Coordinates for d3b7sa2:

Click to download the PDB-style file with coordinates for d3b7sa2.
(The format of our PDB-style files is described here.)

Timeline for d3b7sa2: