PDB entry 3b7s

View 3b7s on RCSB PDB site
Description: [E296Q]LTA4H in complex with RSR substrate
Class: hydrolase
Keywords: transition state, analogue peptide, hydrolysis, alternative splicing, cytoplasm, hydrolase, leukotriene biosynthesis, metal-binding, metalloprotease, multifunctional enzyme, protease, zinc, tripeptide substrate
Deposited on 2007-10-31, released 2008-09-16
The last revision prior to the SCOP 1.75 freeze date was dated 2008-10-07, with a file datestamp of 2008-10-03.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.135
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leukotriene A-4 hydrolase
    Species: Homo sapiens [TaxId:9606]
    Gene: LTA4H, LTA4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09960 (6-615)
      • engineered (301)
    Domains in SCOP 1.75: d3b7sa1, d3b7sa2, d3b7sa3
  • Chain 'B':
    Compound: RSR peptide
  • Heterogens: ZN, YB, ACY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b7sA (A:)
    hhhhhhpeivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvl
    dtkdltiekvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssa
    lqwltpeqtsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsair
    dgetpdpedpsrkiykfiqkvpipcylialvvgalesrqigprtlvwsekeqveksayef
    setesmlkiaedlggpyvwgqydllvlppsfpyggmenpcltfvtptllagdkslsnvia
    hqishswtgnlvtnktwdhfwlneghtvylerhicgrlfgekfrhfnalggwgelqnsvk
    tfgethpftklvvdltdidpdvayssvpyekgfallfyleqllggpeiflgflkayvekf
    syksittddwkdflysyfkdkvdvlnqvdwnawlyspglppikpnydmtltnacialsqr
    witakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrmqevynfnainnsei
    rfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdkshdqavrtyqehkas
    mhpvtamlvgkdlkvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b7sA (A:)
    peivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdlt
    iekvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltp
    eqtsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpd
    pedpsrkiykfiqkvpipcylialvvgalesrqigprtlvwsekeqveksayefsetesm
    lkiaedlggpyvwgqydllvlppsfpyggmenpcltfvtptllagdkslsnviahqishs
    wtgnlvtnktwdhfwlneghtvylerhicgrlfgekfrhfnalggwgelqnsvktfgeth
    pftklvvdltdidpdvayssvpyekgfallfyleqllggpeiflgflkayvekfsyksit
    tddwkdflysyfkdkvdvlnqvdwnawlyspglppikpnydmtltnacialsqrwitake
    ddlnsfnatdlkdlsshqlneflaqtlqraplplghikrmqevynfnainnseirfrwlr
    lciqskwedaiplalkmateqgrmkftrplfkdlaafdkshdqavrtyqehkasmhpvta
    mlvgkdlkvd
    

  • Chain 'B':
    No sequence available.