Lineage for d3b7sa1 (3b7s A:461-610)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775277Superfamily a.118.1: ARM repeat [48371] (23 families) (S)
  5. 775417Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein)
    this is a repeat family; one repeat unit is 1gw6 A:513-547 found in domain
  6. 775418Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species)
  7. 775419Species Human (Homo sapiens) [TaxId:9606] [63610] (15 PDB entries)
    Uniprot P09960
  8. 775420Domain d3b7sa1: 3b7s A:461-610 [154940]
    Other proteins in same PDB: d3b7sa2, d3b7sa3
    automatically matched to d1gw6a1
    complexed with acy, gol, yb, zn; mutant

Details for d3b7sa1

PDB Entry: 3b7s (more details), 1.47 Å

PDB Description: [e296q]lta4h in complex with rsr substrate
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOP Domain Sequences for d3b7sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b7sa1 a.118.1.7 (A:461-610) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm
qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks
hdqavrtyqehkasmhpvtamlvgkdlkvd

SCOP Domain Coordinates for d3b7sa1:

Click to download the PDB-style file with coordinates for d3b7sa1.
(The format of our PDB-style files is described here.)

Timeline for d3b7sa1: