| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (5 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H2B [47119] (6 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (26 PDB entries) |
| Domain d3b6gd1: 3b6g D:22-122 [154895] Other proteins in same PDB: d3b6ga1, d3b6gb1, d3b6gc1, d3b6ge1, d3b6gf1, d3b6gg1 automatically matched to d1s32d_ complexed with mn |
PDB Entry: 3b6g (more details), 3.45 Å
SCOP Domain Sequences for d3b6gd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b6gd1 a.22.1.1 (D:22-122) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahyn
krstitsreiqtavrlllpgelakhavsegtkavtkytsak
Timeline for d3b6gd1: