Lineage for d3b48d_ (3b48 D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1604978Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 1604979Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) (S)
    active dimer is formed by strand 5 swapping
  5. 1604993Family c.54.1.2: DhaM-like [159618] (2 proteins)
    probable link between the PTS system fructose IIA component-like superfamily and the DAK1/DegV-like superfamily (82549)
    automatically mapped to Pfam PF03610
  6. 1605000Protein Uncharacterized protein EF1359 [159619] (1 species)
  7. 1605001Species Enterococcus faecalis [TaxId:1351] [159620] (1 PDB entry)
    Uniprot Q835L8 1-132
  8. 1605005Domain d3b48d_: 3b48 D: [154821]
    automated match to d3b48a1

Details for d3b48d_

PDB Entry: 3b48 (more details), 2.21 Å

PDB Description: Crystal structure of unknown function protein EF1359
PDB Compounds: (D:) Uncharacterized protein

SCOPe Domain Sequences for d3b48d_:

Sequence, based on SEQRES records: (download)

>d3b48d_ c.54.1.2 (D:) Uncharacterized protein EF1359 {Enterococcus faecalis [TaxId: 1351]}
namkadillvshskmitdgikemieqmnaseeitihslggtsdgslgsdpmkiidtinea
dsdreflifadlgsavlsselafdmleedqqkhyhlvdaplvegafasaitagvsddltq
ilaeaqnagkkgw

Sequence, based on observed residues (ATOM records): (download)

>d3b48d_ c.54.1.2 (D:) Uncharacterized protein EF1359 {Enterococcus faecalis [TaxId: 1351]}
namkadillvshskmitdgikemieqmneeitihslggtsdgslgsdpmkiidtineadd
reflifadlgsavlsselafdmleedqqkhyhlvdaplvegafasaitagvsddltqila
eaqnagkkgw

SCOPe Domain Coordinates for d3b48d_:

Click to download the PDB-style file with coordinates for d3b48d_.
(The format of our PDB-style files is described here.)

Timeline for d3b48d_: