SCOP 1.75: Domain d3b48d1: 3b48 D:1-131

Lineage for d3b48d1 (3b48 D:1-131)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.54.1: PTS system fructose IIA component-like [53062] (2 families)
   active dimer is formed by strand 5 swapping

5. Family c.54.1.2: DhaM-like [159618] (2 proteins)
   probable link between the PTS system fructose IIA component-like superfamily and the DAK1/DegV-like superfamily ((82549))
   probable link between the PTS system fructose IIA component-like superfamily and the DAK1/DegV-like superfamily ((82549))

6. Protein Uncharacterized protein EF1359 [159619] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [159620] (1 PDB entry)
   Uniprot Q835L8 1-132

8. Domain d3b48d1: 3b48 D:1-131 [154821]
   automatically matched to 3B48 A:1-132

Details for d3b48d1

PDB Entry: 3b48, 2.21 Å

PDB Description: Crystal structure of unknown function protein EF1359

PDB Compounds: (D:) Uncharacterized protein

SCOP Domain Sequences for d3b48d1:

Sequence, based on SEQRES records:

>d3b48d1 c.54.1.2 (D:1-131) Uncharacterized protein EF1359 {Enterococcus faecalis [TaxId: 1351]}
mkadillvshskmitdgikemieqmnaseeitihslggtsdgslgsdpmkiidtineads
dreflifadlgsavlsselafdmleedqqkhyhlvdaplvegafasaitagvsddltqil
aeaqnagkkgw

Sequence, based on observed residues (ATOM records):

>d3b48d1 c.54.1.2 (D:1-131) Uncharacterized protein EF1359 {Enterococcus faecalis [TaxId: 1351]}
mkadillvshskmitdgikemieqmneeitihslggtsdgslgsdpmkiidtineaddre
flifadlgsavlsselafdmleedqqkhyhlvdaplvegafasaitagvsddltqilaea
qnagkkgw

Timeline for d3b48d1:

• d3b48d1 is new in SCOP 1.75
  
• d3b48d1 is called d3b48d_ in SCOPe 2.01
  
• d3b48d1 appears in the current release, SCOPe 2.08, called d3b48d2