SCOPe 2.06: Domain d2zpib_: 2zpi B:

Lineage for d2zpib_ (2zpi B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families)

5. Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins)
   contains irregular array of helices in the N-terminal extension
   automatically mapped to Pfam PF02211

6. Protein Iron-containing nitrile hydratase [50102] (1 species)

7. Species Rhodococcus erythropolis [TaxId:1833] [50103] (28 PDB entries)
   also Rhodococcus sp. R312

8. Domain d2zpib_: 2zpi B: [154757]
   Other proteins in same PDB: d2zpia_
   automated match to d1ahjb_
   complexed with fe, mg, tb0, trs

Details for d2zpib_

PDB Entry: 2zpi, 1.49 Å

PDB Description: Complex of Fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 440min at 293K

PDB Compounds: (B:) Nitrile hydratase subunit beta

SCOPe Domain Sequences for d2zpib_:

Sequence; same for both SEQRES and ATOM records:

>d2zpib_ b.34.4.4 (B:) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
hvkfaaeelfgsdtdggsvvvdlfegylepa

Timeline for d2zpib_:

• d2zpib_ first appeared in SCOP 1.75, called d2zpib1
  
• d2zpib_ appears in SCOPe 2.05
  
• d2zpib_ appears in SCOPe 2.07
  
• d2zpib_ appears in the current release, SCOPe 2.08