Lineage for d2zpia_ (2zpi A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224127Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 2224128Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) (S)
    duplication: contains two structural repeats
  5. 2224129Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
    automatically mapped to Pfam PF02979
  6. 2224149Protein automated matches [190256] (6 species)
    not a true protein
  7. 2224182Species Rhodococcus erythropolis [TaxId:1833] [187042] (24 PDB entries)
  8. 2224191Domain d2zpia_: 2zpi A: [161601]
    Other proteins in same PDB: d2zpib_
    automated match to d2ahja_
    complexed with fe, mg, tb0, trs

Details for d2zpia_

PDB Entry: 2zpi (more details), 1.49 Å

PDB Description: Complex of Fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 440min at 293K
PDB Compounds: (A:) Nitrile hydratase subunit alpha

SCOPe Domain Sequences for d2zpia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zpia_ d.149.1.1 (A:) automated matches {Rhodococcus erythropolis [TaxId: 1833]}
aqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpefrqll
ltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyksfeyr
arvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqeivtkd
cligvaipqvp

SCOPe Domain Coordinates for d2zpia_:

Click to download the PDB-style file with coordinates for d2zpia_.
(The format of our PDB-style files is described here.)

Timeline for d2zpia_: