![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries) Uniprot P13726 33-242 |
![]() | Domain d2zp0t2: 2zp0 T:109-209 [154749] Other proteins in same PDB: d2zp0h_, d2zp0l1, d2zp0l2, d2zp0l3 automatically matched to d1a21a2 complexed with bgc, ca, fuc, pi0 |
PDB Entry: 2zp0 (more details), 2.7 Å
SCOPe Domain Sequences for d2zp0t2:
Sequence, based on SEQRES records: (download)
>d2zp0t2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkkta ktntneflidvdkgenycfsvqavipsrtvnrkstdspvec
>d2zp0t2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywksgkktaktn tneflidvdkgenycfsvqavipsrtvnrkstdspvec
Timeline for d2zp0t2:
![]() Domains from other chains: (mouse over for more information) d2zp0h_, d2zp0l1, d2zp0l2, d2zp0l3 |