![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Coagulation factor VIIa [50550] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50551] (90 PDB entries) Uniprot P08709 213-466 ! Uniprot P08709 213-446 |
![]() | Domain d2zp0h_: 2zp0 H: [154744] Other proteins in same PDB: d2zp0l1, d2zp0l2, d2zp0l3, d2zp0t1, d2zp0t2 automated match to d1cvwh_ complexed with bgc, ca, fuc, pi0 |
PDB Entry: 2zp0 (more details), 2.7 Å
SCOPe Domain Sequences for d2zp0h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zp0h_ b.47.1.2 (H:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdclqqsrkvgdspniteymfcagy sdgskdsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmr seprpgvllrapfp
Timeline for d2zp0h_: