SCOPe 2.07: Domain d2zo1b2: 2zo1 B:419-622

Lineage for d2zo1b2 (2zo1 B:419-622)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.12: SRA domain-like [159368] (2 proteins)
   Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNA

6. Protein E3 ubiquitin-protein ligase UHRF1 [159369] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [159371] (10 PDB entries)
   Uniprot Q8VDF2 405-613! Uniprot Q8VDF2 418-625

8. Domain d2zo1b2: 2zo1 B:419-622 [154712]
   Other proteins in same PDB: d2zo1b3
   automated match to d2zo0b1
   protein/DNA complex; complexed with edo

Details for d2zo1b2

PDB Entry: 2zo1, 1.96 Å

PDB Description: Mouse NP95 SRA domain DNA specific complex 2

PDB Compounds: (B:) E3 ubiquitin-protein ligase UHRF1

SCOPe Domain Sequences for d2zo1b2:

Sequence; same for both SEQRES and ATOM records:

>d2zo1b2 b.122.1.12 (B:419-622) E3 ubiquitin-protein ligase UHRF1 {Mouse (Mus musculus) [TaxId: 10090]}
panhfgpipgvpvgtmwrfrvqvsesgvhrphvagihgrsndgayslvlaggyeddvdng
nyftytgsggrdlsgnkrtagqssdqkltnnnralalnchspinekgaeaedwrqgkpvr
vvrnmkggkhskyapaegnrydgiykvvkywpergksgflvwryllrrddtepepwtreg
kdrtrqlgltmqypegylealank

Timeline for d2zo1b2:

• d2zo1b2 first appeared in SCOP 1.75, called d2zo1b1
  
• d2zo1b2 appears in SCOPe 2.06
  
• d2zo1b2 appears in the current release, SCOPe 2.08