SCOPe 2.03: Domain d2zlwd_: 2zlw D:

Lineage for d2zlwd_ (2zlw D:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46504] (16 PDB entries)

8. Domain d2zlwd_: 2zlw D: [154677]
   Other proteins in same PDB: d2zlwa_, d2zlwc_
   automated match to d1g0bb_
   complexed with hem

Details for d2zlwd_

PDB Entry: 2zlw, 2.9 Å

PDB Description: horse methemoglobin high salt, ph 7.0 (75% relative humidity)

PDB Compounds: (D:) Hemoglobin subunit beta

SCOPe Domain Sequences for d2zlwd_:

Sequence; same for both SEQRES and ATOM records:

>d2zlwd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh

Timeline for d2zlwd_:

• d2zlwd_ first appeared in SCOP 1.75, called d2zlwd1
  
• d2zlwd_ appears in SCOPe 2.02
  
• d2zlwd_ appears in SCOPe 2.04
  
• d2zlwd_ appears in the current release, SCOPe 2.08