![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (26 species) |
![]() | Species Horse (Equus caballus) [TaxId:9796] [46504] (19 PDB entries) |
![]() | Domain d2zlwd_: 2zlw D: [154677] Other proteins in same PDB: d2zlwa_, d2zlwc_ automated match to d1g0bb_ complexed with hem |
PDB Entry: 2zlw (more details), 2.9 Å
SCOPe Domain Sequences for d2zlwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zlwd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]} vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk dftpelqasyqkvvagvanalahkyh
Timeline for d2zlwd_: