Lineage for d2zlwd_ (2zlw D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2300379Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2300478Species Horse (Equus caballus) [TaxId:9796] [46504] (17 PDB entries)
  8. 2300499Domain d2zlwd_: 2zlw D: [154677]
    Other proteins in same PDB: d2zlwa_, d2zlwc_
    automated match to d1g0bb_
    complexed with hem

Details for d2zlwd_

PDB Entry: 2zlw (more details), 2.9 Å

PDB Description: Horse methemoglobin high salt, pH 7.0 (75% relative humidity)
PDB Compounds: (D:) Hemoglobin subunit beta

SCOPe Domain Sequences for d2zlwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zlwd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh

SCOPe Domain Coordinates for d2zlwd_:

Click to download the PDB-style file with coordinates for d2zlwd_.
(The format of our PDB-style files is described here.)

Timeline for d2zlwd_: