Lineage for d2zjqe1 (2zjq E:83-172)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217079Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 2217080Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
    automatically mapped to Pfam PF00347
  5. 2217081Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 2217082Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 2217086Species Deinococcus radiodurans [TaxId:1299] [160798] (6 PDB entries)
    Uniprot Q9RSL3 8-82! Uniprot Q9RSL3 83-172
  8. 2217093Domain d2zjqe1: 2zjq E:83-172 [154527]
    Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1
    automatically matched to 2ZJR E:83-172
    protein/RNA complex

Details for d2zjqe1

PDB Entry: 2zjq (more details), 3.3 Å

PDB Description: Interaction of L7 with L11 induced by Microccocin binding to the Deinococcus radiodurans 50S subunit
PDB Compounds: (E:) 50S ribosomal protein L6

SCOPe Domain Sequences for d2zjqe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjqe1 d.141.1.1 (E:83-172) Ribosomal protein L6 {Deinococcus radiodurans [TaxId: 1299]}
ytinlelrgvgfrakltgkalemnigyshpviieppagvtfavpeptridvsgidkqlvg
qvaanvrkvrkpdayhgkgvrfvgeqialk

SCOPe Domain Coordinates for d2zjqe1:

Click to download the PDB-style file with coordinates for d2zjqe1.
(The format of our PDB-style files is described here.)

Timeline for d2zjqe1: