Lineage for d2zjqo1 (2zjq O:5-98)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2089175Fold b.155: L21p-like [141090] (1 superfamily)
    core: sandwich, 6 strands in 2 sheets
  4. 2089176Superfamily b.155.1: L21p-like [141091] (1 family) (S)
    automatically mapped to Pfam PF00829
  5. 2089177Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
    Pfam PF00829
  6. 2089178Protein Ribosomal protein L21p [141093] (3 species)
  7. 2089179Species Deinococcus radiodurans [TaxId:1299] [158938] (6 PDB entries)
    Uniprot Q9RY64 5-98
  8. 2089183Domain d2zjqo1: 2zjq O:5-98 [154539]
    Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1
    automatically matched to 2ZJR O:5-98
    protein/RNA complex

Details for d2zjqo1

PDB Entry: 2zjq (more details), 3.3 Å

PDB Description: Interaction of L7 with L11 induced by Microccocin binding to the Deinococcus radiodurans 50S subunit
PDB Compounds: (O:) 50S ribosomal protein L21

SCOPe Domain Sequences for d2zjqo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjqo1 b.155.1.1 (O:5-98) Ribosomal protein L21p {Deinococcus radiodurans [TaxId: 1299]}
iqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaevvehg
rgkkiyirkyksgvqyrrrtghrqnftaikilgi

SCOPe Domain Coordinates for d2zjqo1:

Click to download the PDB-style file with coordinates for d2zjqo1.
(The format of our PDB-style files is described here.)

Timeline for d2zjqo1: