Lineage for d2zgya1 (2zgy A:1-157)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605037Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1605386Protein Plasmid segregation protein ParM [82438] (1 species)
  7. 1605387Species Escherichia coli [TaxId:562] [82439] (6 PDB entries)
  8. 1605388Domain d2zgya1: 2zgy A:1-157 [154425]
    automated match to d1mwma1
    complexed with gdp, mg

Details for d2zgya1

PDB Entry: 2zgy (more details), 1.9 Å

PDB Description: parm with gdp
PDB Compounds: (A:) Plasmid segregation protein parM

SCOPe Domain Sequences for d2zgya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zgya1 c.55.1.1 (A:1-157) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]}
mlvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpi
spdavvttniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenie
rkkanfrkkitlnggdtftikdvkvmpesipagyevl

SCOPe Domain Coordinates for d2zgya1:

Click to download the PDB-style file with coordinates for d2zgya1.
(The format of our PDB-style files is described here.)

Timeline for d2zgya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zgya2