| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
| Protein Plasmid segregation protein ParM [82438] (1 species) |
| Species Escherichia coli [TaxId:562] [82439] (6 PDB entries) |
| Domain d2zgya1: 2zgy A:1-157 [154425] automated match to d1mwma1 complexed with gdp, mg missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 2zgy (more details), 1.9 Å
SCOPe Domain Sequences for d2zgya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zgya1 c.55.1.1 (A:1-157) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]}
mlvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpi
spdavvttniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenie
rkkanfrkkitlnggdtftikdvkvmpesipagyevl
Timeline for d2zgya1: