Lineage for d2zgya2 (2zgy A:158-320)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883827Protein Plasmid segregation protein ParM [82438] (1 species)
  7. 2883828Species Escherichia coli [TaxId:562] [82439] (6 PDB entries)
  8. 2883830Domain d2zgya2: 2zgy A:158-320 [154426]
    automated match to d1mwma2
    complexed with gdp, mg

    missing some secondary structures that made up less than one-third of the common domain

Details for d2zgya2

PDB Entry: 2zgy (more details), 1.9 Å

PDB Description: parm with gdp
PDB Compounds: (A:) Plasmid segregation protein parM

SCOPe Domain Sequences for d2zgya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]}
qeldeldslliidlggttldisqvmgklsgiskiygdsslgvslvtsavkdalslartkg
ssyladdiiihrkdnnylkqrindenkisivteamnealrkleqrvlntlnefsgythvm
vigggaelicdavkkhtqirderffktnnsqydlvngmylign

SCOPe Domain Coordinates for d2zgya2:

Click to download the PDB-style file with coordinates for d2zgya2.
(The format of our PDB-style files is described here.)

Timeline for d2zgya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zgya1