Lineage for d2zc4e_ (2zc4 E:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013522Protein Penicillin-binding protein 2x (pbp-2x), transpeptidase domain [56624] (1 species)
  7. 3013523Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [56625] (10 PDB entries)
  8. 3013528Domain d2zc4e_: 2zc4 E: [154333]
    Other proteins in same PDB: d2zc4c1, d2zc4c2, d2zc4f1, d2zc4f2
    automated match to d2zc4b1
    complexed with so4, teb

Details for d2zc4e_

PDB Entry: 2zc4 (more details), 2.8 Å

PDB Description: Penicillin-binding protein 2X (PBP 2X) acyl-enzyme complex (tebipenem) from Streptococcus pneumoniae
PDB Compounds: (E:) penicillin-binding protein 2x

SCOPe Domain Sequences for d2zc4e_:

Sequence, based on SEQRES records: (download)

>d2zc4e_ e.3.1.1 (E:) Penicillin-binding protein 2x (pbp-2x), transpeptidase domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
rtmdgkdvyttissplqsfmetqmdafqekvkgkymtatlvsaktgeilattqrptfdad
tkegitedfvwrdilyqsnyepgstmkvmmlaaaidnntfpggevfnsselkiadatird
wdvnegltggrmmtfsqgfahssnvgmtlleqkmgdatwldylnrfkfgvptrfgltdey
agqlpadnivniaqssfgqgisvtqtqmiraftaiandgvmlepkfisaiydpndqtark
sqkeivgnpvskdaasltrtnmvlvgtdpvygtmynhstgkptvtvpgqnvalksgtaqi
adeknggylvgltdyifsavsmspaenpdfilyvtvqqpehysgiqlgefanpilerasa
mkdslnl

Sequence, based on observed residues (ATOM records): (download)

>d2zc4e_ e.3.1.1 (E:) Penicillin-binding protein 2x (pbp-2x), transpeptidase domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
rtmdgkdvyttissplqsfmetqmdafqekvkgkymtatlvsaktgeilattqrptfdad
tkegitedfvwrdilyqsnyepgstmkvmmlaaaidnntfpggevfnsselkiadatird
wdvnltggrmmtfsqgfahssnvgmtlleqkmgdatwldylnrfkfgvptrfgltdeyag
qlpadnivniaqssfgqgisvtqtqmiraftaiandgvmlepkfisaiydpndqtarksq
keivgnpvskdaasltrtnmvlvgtdpvygtmynhstgkptvtvpgqnvalksgtaqiad
eknggylvgltdyifsavsmspaenpdfilyvtvqqpehysgiqlgefanpilerasamk
dslnl

SCOPe Domain Coordinates for d2zc4e_:

Click to download the PDB-style file with coordinates for d2zc4e_.
(The format of our PDB-style files is described here.)

Timeline for d2zc4e_: