SCOPe 2.08: Domain d2z93d1: 2z93 D:1-107

Lineage for d2z93d1 (2z93 D:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (43 PDB entries)
   Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1

8. Domain d2z93d1: 2z93 D:1-107 [154230]
   Other proteins in same PDB: d2z93a_, d2z93c_, d2z93d2
   automated match to d1h3pl1
   complexed with end

Details for d2z93d1

PDB Entry: 2z93, 2.4 Å

PDB Description: crystal structure of fab fragment of anti-ciguatoxin antibody 10c9 in complex with ctx3c-abcd

PDB Compounds: (D:) Anti-ciguatoxin antibody 10C9 Fab light chain

SCOPe Domain Sequences for d2z93d1:

Sequence; same for both SEQRES and ATOM records:

>d2z93d1 b.1.1.1 (D:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
elvmtqtpaimsaspgekvtmtcsasssvssvhwyqqksgtspkrwiydtsklpsgvpgr
fsgsgsgtsysltissmeaedaatyycqqwssnpptfgagtklevk

Timeline for d2z93d1:

• d2z93d1 first appeared in SCOP 1.75
  
• d2z93d1 appears in SCOPe 2.07