SCOPe 2.08: Domain d2z93a_: 2z93 A:

Lineage for d2z93a_ (2z93 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d2z93a_: 2z93 A: [154228]
   Other proteins in same PDB: d2z93d1, d2z93d2
   automated match to d6shgh_
   complexed with end

Details for d2z93a_

PDB Entry: 2z93, 2.4 Å

PDB Description: crystal structure of fab fragment of anti-ciguatoxin antibody 10c9 in complex with ctx3c-abcd

PDB Compounds: (A:) Anti-ciguatoxin antibody 10C9 Fab heavy chain

SCOPe Domain Sequences for d2z93a_:

Sequence, based on SEQRES records:

>d2z93a_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
tlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

Sequence, based on observed residues (ATOM records):

>d2z93a_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ttppsvyplapgsavtlgclvkgyfpepvtvtwnsgvhtfpavlqsdlytlsssvtvpse
tvtcnvahpasstkvdkkivp

Timeline for d2z93a_:

• d2z93a_ first appeared in SCOP 1.75, called d2z93a1
  
• d2z93a_ was called d2z93a1 in SCOPe 2.07