SCOPe 2.04: Domain d2z6wa_: 2z6w A:

Lineage for d2z6wa_ (2z6w A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F [141511] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141512] (27 PDB entries)
   Uniprot P30405 44-207

8. Domain d2z6wa_: 2z6w A: [154184]
   automated match to d2bitx1
   complexed with cit

Details for d2z6wa_

PDB Entry: 2z6w, 0.96 Å

PDB Description: Crystal structure of human cyclophilin D in complex with cyclosporin A

PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d2z6wa_:

Sequence; same for both SEQRES and ATOM records:

>d2z6wa_ b.62.1.1 (A:) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]}
gnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsfm
cqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktdw
ldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls

Timeline for d2z6wa_:

• d2z6wa_ first appeared in SCOP 1.75, called d2z6wa1
  
• d2z6wa_ appears in SCOPe 2.03
  
• d2z6wa_ appears in SCOPe 2.05
  
• d2z6wa_ appears in the current release, SCOPe 2.08