Lineage for d2z6ka_ (2z6k A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2398969Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 2399037Protein Replication protein A 32 KDa subunit (RPA32) fragment [50269] (1 species)
  7. 2399038Species Human (Homo sapiens) [TaxId:9606] [50270] (5 PDB entries)
  8. 2399045Domain d2z6ka_: 2z6k A: [154176]
    Other proteins in same PDB: d2z6kc_, d2z6kd_
    automated match to d2pqaa_

Details for d2z6ka_

PDB Entry: 2z6k (more details), 3 Å

PDB Description: Crystal structure of full-length human RPA14/32 heterodimer
PDB Compounds: (A:) Replication protein A 32 kDa subunit

SCOPe Domain Sequences for d2z6ka_:

Sequence, based on SEQRES records: (download)

>d2z6ka_ b.40.4.3 (A:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]}
raqhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaap
mdvrqwvdtddtssentvvppetyvkvaghlrsfqnkkslvafkimpledmneftthile
vinahmvlskansq

Sequence, based on observed residues (ATOM records): (download)

>d2z6ka_ b.40.4.3 (A:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]}
raqhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaap
mdvrqwvdntvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevinahmv
lskansq

SCOPe Domain Coordinates for d2z6ka_:

Click to download the PDB-style file with coordinates for d2z6ka_.
(The format of our PDB-style files is described here.)

Timeline for d2z6ka_: