SCOPe 2.08: Domain d2z68b_: 2z68 B:

Lineage for d2z68b_ (2z68 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase HmuO [89159] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [89160] (16 PDB entries)
   Uniprot P71119

8. Domain d2z68b_: 2z68 B: [154175]
   automated match to d1iw1a_
   complexed with na, so4, til

Details for d2z68b_

PDB Entry: 2z68, 1.58 Å

PDB Description: Crystal Structure Of An Artificial Metalloprotein: Cr[N-salicylidene-4-amino-3-hydroxyhydrocinnamic acid]/Wild Type Heme oxygenase

PDB Compounds: (B:) Heme oxygenase

SCOPe Domain Sequences for d2z68b_:

Sequence; same for both SEQRES and ATOM records:

>d2z68b_ a.132.1.1 (B:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlgkg

Timeline for d2z68b_:

• d2z68b_ first appeared in SCOP 1.75, called d2z68b1
  
• d2z68b_ appears in SCOPe 2.07