SCOP 1.75: Domain d2z68b1: 2z68 B:7-213

Lineage for d2z68b1 (2z68 B:7-213)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (3 proteins)

6. Protein Heme oxygenase HmuO [89159] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [89160] (10 PDB entries)
   Uniprot P71119

8. Domain d2z68b1: 2z68 B:7-213 [154175]
   automatically matched to d1iw1a_
   complexed with na, so4, til

Details for d2z68b1

PDB Entry: 2z68, 1.58 Å

PDB Description: Crystal Structure Of An Artificial Metalloprotein: Cr[N-salicylidene-4-amino-3-hydroxyhydrocinnamic acid]/Wild Type Heme oxygenase

PDB Compounds: (B:) Heme oxygenase

SCOP Domain Sequences for d2z68b1:

Sequence; same for both SEQRES and ATOM records:

>d2z68b1 a.132.1.1 (B:7-213) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlgk

Timeline for d2z68b1:

• d2z68b1 is new in SCOP 1.75
  
• d2z68b1 is called d2z68b_ in SCOPe 2.01
  
• d2z68b1 appears in the current release, SCOPe 2.08, called d2z68b_