| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily) alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143 |
Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) ![]() automatically mapped to Pfam PF00189 |
| Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein) |
| Protein Ribosomal protein S3 C-terminal domain [54823] (2 species) |
| Species Escherichia coli [TaxId:562] [160263] (24 PDB entries) Uniprot P0A7V3 106-206 |
| Domain d2z4mc2: 2z4m C:106-206 [154107] Other proteins in same PDB: d2z4mb1, d2z4mc1, d2z4md1, d2z4me1, d2z4me2, d2z4mf1, d2z4mg1, d2z4mh1, d2z4mi1, d2z4mj1, d2z4mk1, d2z4ml1, d2z4mm1, d2z4mn1, d2z4mp1, d2z4mq1, d2z4mr1, d2z4ms1, d2z4mt1, d2z4mu1 protein/RNA complex; complexed with mg, par protein/RNA complex; complexed with mg, par |
PDB Entry: 2z4m (more details), 4.45 Å
SCOPe Domain Sequences for d2z4mc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z4mc2 d.53.1.1 (C:106-206) Ribosomal protein S3 C-terminal domain {Escherichia coli [TaxId: 562]}
rkpeldaklvadsitsqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiarte
wyregrvplhtlradidyntseahttygvigvkvwifkgei
Timeline for d2z4mc2: