![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.75: Ribosomal protein S7 [47972] (1 superfamily) core: 5 helices; contains one more helix and a beta-hairpin outside the core |
![]() | Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) ![]() |
![]() | Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein) |
![]() | Protein Ribosomal protein S7 [47975] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [158599] (24 PDB entries) Uniprot P02359 2-151 |
![]() | Domain d2z4mg1: 2z4m G:2-151 [154112] Other proteins in same PDB: d2z4mb1, d2z4mc1, d2z4mc2, d2z4md1, d2z4me1, d2z4me2, d2z4mf1, d2z4mh1, d2z4mi1, d2z4mj1, d2z4mk1, d2z4ml1, d2z4mm1, d2z4mn1, d2z4mp1, d2z4mq1, d2z4mr1, d2z4ms1, d2z4mt1, d2z4mu1 protein/RNA complex; complexed with mg, par protein/RNA complex; complexed with mg, par |
PDB Entry: 2z4m (more details), 4.45 Å
SCOPe Domain Sequences for d2z4mg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z4mg1 a.75.1.1 (G:2-151) Ribosomal protein S7 {Escherichia coli [TaxId: 562]} rrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkseleaf evalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrlan elsdaaenkgtavkkredvhrmaeankafa
Timeline for d2z4mg1: