Lineage for d2z4mh1 (2z4m H:2-128)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1970698Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1970699Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1970700Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 1970701Protein 70S ribosome functional complex [58121] (4 species)
  7. 1970702Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1970752Domain d2z4mh1: 2z4m H:2-128 [154113]
    Other proteins in same PDB: d2z4mb1, d2z4mc1, d2z4mc2, d2z4md1, d2z4me1, d2z4me2, d2z4mf1, d2z4mg1, d2z4mi1, d2z4mj1, d2z4mk1, d2z4ml1, d2z4mm1, d2z4mn1, d2z4mp1, d2z4mq1, d2z4mr1, d2z4ms1, d2z4mt1, d2z4mu1
    protein/RNA complex; complexed with mg, par
    protein/RNA complex; complexed with mg, par

Details for d2z4mh1

PDB Entry: 2z4m (more details), 4.45 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with paromomycin and ribosome recycling factor (RRF). This file contains the 30S subunit of the second 70S ribosome, with paromomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d2z4mh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z4mh1 i.1.1.1 (H:2-128) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
mqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelelt
lkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglg
geiicyv

SCOPe Domain Coordinates for d2z4mh1:

Click to download the PDB-style file with coordinates for d2z4mh1.
(The format of our PDB-style files is described here.)

Timeline for d2z4mh1: