Lineage for d2z46d_ (2z46 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739026Fold a.280: RbcX-like [158614] (1 superfamily)
    5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer
  4. 2739027Superfamily a.280.1: RbcX-like [158615] (2 families) (S)
  5. 2739028Family a.280.1.1: RbcX-like [158616] (1 protein)
    Pfam PF02341 (note typo in the Pfam name: RcbX)
  6. 2739029Protein RuBisCo chaperone RbcX [158617] (5 species)
  7. 2739069Species Synechococcus sp. [TaxId:32049] [255545] (4 PDB entries)
  8. 2739076Domain d2z46d_: 2z46 D: [154033]
    automated match to d2pema1

Details for d2z46d_

PDB Entry: 2z46 (more details), 2.97 Å

PDB Description: Crystal Structure of Native-ORF134
PDB Compounds: (D:) orf134

SCOPe Domain Sequences for d2z46d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z46d_ a.280.1.1 (D:) RuBisCo chaperone RbcX {Synechococcus sp. [TaxId: 32049]}
mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerlt

SCOPe Domain Coordinates for d2z46d_:

Click to download the PDB-style file with coordinates for d2z46d_.
(The format of our PDB-style files is described here.)

Timeline for d2z46d_: