Class a: All alpha proteins [46456] (290 folds) |
Fold a.280: RbcX-like [158614] (1 superfamily) 5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer |
Superfamily a.280.1: RbcX-like [158615] (2 families) |
Family a.280.1.1: RbcX-like [158616] (1 protein) Pfam PF02341 (note typo in the Pfam name: RcbX) |
Protein RuBisCo chaperone RbcX [158617] (5 species) |
Species Synechococcus sp. [TaxId:32049] [255545] (4 PDB entries) |
Domain d2z46d_: 2z46 D: [154033] automated match to d2pema1 |
PDB Entry: 2z46 (more details), 2.97 Å
SCOPe Domain Sequences for d2z46d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z46d_ a.280.1.1 (D:) RuBisCo chaperone RbcX {Synechococcus sp. [TaxId: 32049]} mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerlt
Timeline for d2z46d_: