PDB entry 2z46

View 2z46 on RCSB PDB site
Description: Crystal Structure of Native-ORF134
Class: chaperone
Keywords: chaperone, helix bundle
Deposited on 2007-06-12, released 2008-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.97 Å
R-factor: 0.25
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orf134
    Species: Synechococcus sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z46a_
  • Chain 'B':
    Compound: orf134
    Species: Synechococcus sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z46b_
  • Chain 'C':
    Compound: orf134
    Species: Synechococcus sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z46c_
  • Chain 'D':
    Compound: orf134
    Species: Synechococcus sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z46d_
  • Chain 'E':
    Compound: orf134
    Species: Synechococcus sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z46e_
  • Chain 'F':
    Compound: orf134
    Species: Synechococcus sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z46f_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z46A (A:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvdssstdqt
    epnpgesdtsedse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z46A (A:)
    efkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamm
    lenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerlt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z46B (B:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvdssstdqt
    epnpgesdtsedse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z46B (B:)
    efkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamm
    lenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerlt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2z46C (C:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvdssstdqt
    epnpgesdtsedse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z46C (C:)
    fkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamml
    enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2z46D (D:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvdssstdqt
    epnpgesdtsedse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z46D (D:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerlt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2z46E (E:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvdssstdqt
    epnpgesdtsedse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z46E (E:)
    fkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamml
    enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2z46F (F:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvdssstdqt
    epnpgesdtsedse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z46F (F:)
    efkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamm
    lenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqv